PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02286.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 29128.2 Da    PI: 7.8881
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02286.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.6e-28959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   k+ien   rqvtfskRr g++KKA+ELSvLCdaevavi+fsstgklye+ss
  Jcr4S02286.50  9 KKIENLNSRQVTFSKRRSGLIKKAKELSVLCDAEVAVIVFSSTGKLYEFSS 59
                   68***********************************************96 PP

2K-box676.4e-239017614100
          K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                    ++s ++e++ Lk+e+++L+ +  +++G++L+ Ls+keLqqLe+qL ++  ++++kK++++leq+++++ +e+++ +en++Lrk++ee
  Jcr4S02286.50  90 EQSQSEEVTALKDEVSKLRLTCLQMMGQQLDGLSFKELQQLEHQLTEGRISVKEKKEKVILEQLKKSRLQEQKAIQENETLRKQVEE 176
                    68899*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.7E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.842161IPR002100Transcription factor, MADS-box
CDDcd002659.58E-38261No hitNo description
SuperFamilySSF554556.28E-30265IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.9E-1790174IPR002487Transcription factor, K-box
PROSITE profilePS5129713.1890180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010047Biological Processfruit dehiscence
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0060862Biological Processnegative regulation of floral organ abscission
GO:0060867Biological Processfruit abscission
GO:0071365Biological Processcellular response to auxin stimulus
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGKIEIKK IENLNSRQVT FSKRRSGLIK KAKELSVLCD AEVAVIVFSS TGKLYEFSSS  60
SLTWNKLCQD IAKARILMCP EHASDYPGTE QSQSEEVTAL KDEVSKLRLT CLQMMGQQLD  120
GLSFKELQQL EHQLTEGRIS VKEKKEKVIL EQLKKSRLQE QKAIQENETL RKQVEELKRS  180
SAMAKSQFQE FNPLERRFPL ASFKSDCFPQ GEEEDYGDLS ETSLHLGLSY DVHHKRKAAK  240
IEPIWNDSAG SQVASE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17162162Myocyte-specific enhancer factor 2B
1tqe_Q2e-17162162Myocyte-specific enhancer factor 2B
1tqe_R2e-17162162Myocyte-specific enhancer factor 2B
1tqe_S2e-17162162Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00508DAPTransfer from AT5G13790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119692e-96AP011969.1 Jatropha curcas DNA, clone: JHL06B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086200.11e-174PREDICTED: MADS-box transcription factor 23 isoform X1
TrEMBLE6NU981e-174E6NU98_JATCU; JHL06B08.10 protein
STRINGPOPTR_0006s04730.11e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35823260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.12e-60AGAMOUS-like 15